DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT4G32120

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:213 Identity:46/213 - (21%)
Similarity:87/213 - (40%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTW-GYEGRFSDVHLRRV---FLLGTA----EDSEKDVAWESREHGDILQ 140
            :.:..|:..:|...|.:| ..:.....:..|.|   |::|.:    :..::.:..|:|...|.|.
plant   124 VYTGFGSHLKRNKFRGSWMPRDDALKKLEERGVVIRFVIGRSANRGDSLDRKIDEENRATKDFLI 188

  Fly   141 AEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGH 205
            .|..:.......|.:.....|:.|...:|||:.|||:..:..:.::..| ..|:|.  :..:.|.
plant   189 LENHEEAQEELPKKVKFFYSAAVQNWDAEFYVKVDDNVDLDLEGMIALL-ESRRSQ--DGAYIGC 250

  Fly   206 VFQTSPLRHKFSKWYVSLEEYPFDRWPPY---VTAGAFILSQKALRQLYAASVHLPLFRFDDVYL 267
            :.....:..:.|:|| ..|.:.|.....|   .|....|||:...:.:...|..|..:.|||..:
plant   251 MKSGDVITEEGSQWY-EPEWWKFGDDKSYFRHATGSLVILSKNLAQYVNINSGLLKTYAFDDTTI 314

  Fly   268 GIVALKAGISLQHCDDFR 285
            |  :...|:...:.||.|
plant   315 G--SWMIGVQATYIDDNR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 42/200 (21%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073
Galactosyl_T 134..328 CDD:304462 42/199 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.