DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT4G26940

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_567762.1 Gene:AT4G26940 / 828801 AraportID:AT4G26940 Length:407 Species:Arabidopsis thaliana


Alignment Length:229 Identity:56/229 - (24%)
Similarity:99/229 - (43%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTW---GYEGRFSD----VHLRRVFLLGTAEDS----EKDVAWESREHGD 137
            :.:|..:.:||:::|.||   |.|.:..:    :.:|  |::|.:...    ::.:..|..:|||
plant   145 VNTAFSSRKRRDSVRATWMPPGEERKKLEEEKGIVMR--FVIGHSSTPGGILDRAIQAEESKHGD 207

  Fly   138 ILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL-- 200
            .|:.:..:.|...:.||......|...:: ::||:.||||.:|:...:...|.|.|.  :|.:  
plant   208 FLRLDHVEGYLELSAKTKTYFTTAFAMWD-ADFYVKVDDDVHVNIATLGAELARYRM--KPRVYI 269

  Fly   201 --LFAGHVFQTSPLR-HKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLP---- 258
              :.:|.|.....:| |:...|....|...:.|              .|..||||.|..|.    
plant   270 GCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFR--------------HATGQLYAISRELASYIS 320

  Fly   259 -----LFRF--DDVYLGIVALKAGISLQHCDDFR 285
                 |.::  :||.||...|  |:.::|.||.|
plant   321 INQNVLHKYVNEDVSLGSWFL--GLDVEHVDDRR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 52/216 (24%)
AT4G26940NP_567762.1 PLN03193 1..407 CDD:178735 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.