DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT3G14960

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_188114.1 Gene:AT3G14960 / 820725 AraportID:AT3G14960 Length:343 Species:Arabidopsis thaliana


Alignment Length:211 Identity:55/211 - (26%)
Similarity:81/211 - (38%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTW---GYEGRFSDVHLRRV---------FLLGTAEDSEKDVAWESR--E 134
            |::...::.||.|:|.||   ..||      |||:         |::|..:|..|.|...|.  .
plant    90 IQTGFRSAGRRRALRNTWMPSDPEG------LRRLEESTGLAIRFIIGKTKDEAKMVELRSEVAM 148

  Fly   135 HGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPE 199
            :.|.:..:..:.|.....||:...:.|...:: ||||:..|||.|:....:...|.:.|...|..
plant   149 YDDFILLDIEEEYSKLPYKTLAFFKAAYALYD-SEFYVKADDDIYLRPDRLSLLLAKERGHSQTY 212

  Fly   200 L--LFAGHVFQTSPLRHKFSKWYVSL-----EEYPFDRWPPYVTAGAFILSQKALRQLYAASVHL 257
            |  :..|.||....|     |||..|     :||....:.|                :||.|.  
plant   213 LGCMKKGPVFTDPKL-----KWYEPLADLLGKEYFLHAYGP----------------IYALSA-- 254

  Fly   258 PLFRFDDVYLGIVALK 273
                  ||...:||||
plant   255 ------DVVTSLVALK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 54/203 (27%)
AT3G14960NP_188114.1 Galactosyl_T 99..293 CDD:304462 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.