DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT3G06440

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_566284.1 Gene:AT3G06440 / 819820 AraportID:AT3G06440 Length:619 Species:Arabidopsis thaliana


Alignment Length:298 Identity:83/298 - (27%)
Similarity:138/298 - (46%) Gaps:48/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIK--SAVGNSRRREAIRRTW-GYE 104
            |:.||    .||..:::  .|:.||.:.       .|:.:|:.  |...|.:||.|:||:| .||
plant   347 PIPDD----HASLIIEE--KLKAPSLSG-------TRIELLVGVFSTGNNFKRRMALRRSWMQYE 398

  Fly   105 G-RFSDVHLRRVFLLG--TAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKT----MLGMRWAS 162
            . |...|.:|  ||:|  |.|....::..||:.:|||....|.|.|...:|||    :||.:...
plant   399 AVRSGKVAVR--FLIGLHTNEKVNLEMWRESKAYGDIQFMPFVDYYGLLSLKTVALCILGTKVIP 461

  Fly   163 DQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYP 227
                 :::.:..|||.:|....:|..|   .:.....||:....|.:||.|.:.|||::..||:|
plant   462 -----AKYIMKTDDDAFVRIDELLSSL---EERPSSALLYGLISFDSSPDREQGSKWFIPKEEWP 518

  Fly   228 FDRWPPYVTAGAFILSQKALRQLYAASVH----LPLFRFDDVYLGIVALKAGISL---QHCDDFR 285
            .|.:||:.....:|:|....:  :....|    |.||:.:||.:||...:...::   ::.:|.|
plant   519 LDSYPPWAHGPGYIISHDIAK--FVVKGHRQRDLGLFKLEDVAMGIWIQQFNQTIKRVKYINDKR 581

  Fly   286 FHRPAYKGPDSYSSVIASHEFGDPEEMTRVWNECRSAN 323
            ||     ..|..|:.|..| :..|..:..:|.:.:..|
plant   582 FH-----NSDCKSNYILVH-YQTPRLILCLWEKLQKEN 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 60/204 (29%)
AT3G06440NP_566284.1 PLN03133 19..618 CDD:215596 83/298 (28%)
Gal-bind_lectin 165..343 CDD:278752
Galactosyl_T 385..563 CDD:304462 59/189 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.