DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT2G32430

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_180802.1 Gene:AT2G32430 / 817804 AraportID:AT2G32430 Length:409 Species:Arabidopsis thaliana


Alignment Length:227 Identity:57/227 - (25%)
Similarity:99/227 - (43%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTWGYEG-------RFSDVHLRRVFLLGTAEDS----EKDVAWESREHGD 137
            |.:|..:.:||:::|.||...|       ....:.:|  |::|.:..:    ::.:..|.::|||
plant   146 INTAFSSRKRRDSVRTTWMPSGEKRKKLEEEKGIIIR--FVIGHSATAGGILDRSIEAEDKKHGD 208

  Fly   138 ILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL-- 200
            .|:.:..:.|...:.||......|..::: :|||:.||||.:|:...:.:.|.|.|:.|:..|  
plant   209 FLRLDHVEGYLELSGKTKTYFSTAVSKWD-AEFYVKVDDDVHVNIATLGETLVRHRKKHRVYLGC 272

  Fly   201 LFAGHVFQTSPLR-HKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLP------ 258
            :.:|.|.....:| |:...|........:.|              .|..||||.|..|.      
plant   273 MKSGPVLSQKGVRYHEPEYWKFGENGNKYFR--------------HATGQLYAISRDLASYISLN 323

  Fly   259 ---LFRF--DDVYLGIVALKAGISLQHCDDFR 285
               |.::  :||.||  |...|:.:.|.||.|
plant   324 QHVLHKYANEDVTLG--AWFIGLDVTHIDDRR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 52/214 (24%)
AT2G32430NP_180802.1 PLN03193 1..409 CDD:178735 57/227 (25%)
DUF4094 17..115 CDD:290073
Galactosyl_T 154..352 CDD:304462 53/216 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.