DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT2G26100

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_180179.2 Gene:AT2G26100 / 817150 AraportID:AT2G26100 Length:371 Species:Arabidopsis thaliana


Alignment Length:218 Identity:52/218 - (23%)
Similarity:92/218 - (42%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTWGYEGRFSDVHLRRV------FLLGTAEDSEK--DVAWESREHGDILQ 140
            |::...:..||.|:|.||......|.:.|.:.      |::|.::|::|  ::..|.:|:.|.:.
plant   116 IQTGFDSGDRRTALRSTWFPSDPDSLLRLEQATGLAFRFVIGKSKDAKKMAELEKEIKEYRDFVL 180

  Fly   141 AEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL--LFA 203
            .:..:.|.....||:...:.|...| .:::|:..|||.|:....:...|...|...|..:  :..
plant   181 LDTEEEYIRLPYKTLAFFKAAFKLF-EADYYVKADDDIYLRPDRLATLLANERLHSQTYIGCMKK 244

  Fly   204 GHVFQTSPLRHKFSKWYVSL-----EEYPFDRWPPYVTAGAFILSQKALRQLYAA-SVHLPLFRF 262
            |.|.....|     |||...     .||....:.|     .::||.:.:..|.|| :..|.:|..
plant   245 GPVITDPKL-----KWYEKQGNLIGNEYFLHAYGP-----IYVLSAEIVASLAAARNGSLRMFNN 299

  Fly   263 DDVYLGIVALKAGISLQHCDDFR 285
            :||.:|...|...:   |.:|.|
plant   300 EDVTIGSWMLAMDV---HHEDNR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 49/205 (24%)
AT2G26100NP_180179.2 Galactosyl_T 124..319 CDD:250845 50/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.