DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT2G25300

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_180102.3 Gene:AT2G25300 / 817068 AraportID:AT2G25300 Length:346 Species:Arabidopsis thaliana


Alignment Length:270 Identity:61/270 - (22%)
Similarity:105/270 - (38%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAI 97
            ||...:...|..|..:||   |||....|.:.|                   .|..|:..||...
plant    96 ELTLAKSQGYLKNLKSGS---SSGKKLLAVIGV-------------------YSGFGSHLRRNTF 138

  Fly    98 RRTWGYEGRFSDVHLRRV--------FLLGTA----EDSEKDVAWESREHGDILQAEFTDAYFNN 150
            |.::..:|   |. ||::        |::|.:    :..::.:..|::...|.|..|..:.....
plant   139 RGSYMPQG---DA-LRKLEERGIVIRFVIGRSPNRGDSLDRKIDEENQARKDFLILENHEEAQEE 199

  Fly   151 TLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFL--GRGRQSHQPELLFAGHVFQTSPLR 213
            ..|.:.....|:.|...:|||:.|||:..:..:.::..|  .||:.:.....:.:|.|     :.
plant   200 LAKKVKFFFSAAVQNWDAEFYIKVDDNIDLDLEGLIGLLESRRGQDAAYIGCMKSGEV-----VA 259

  Fly   214 HKFSKWYVSLEEYPFDRWPPYV--TAGAFILSQKALRQ-LYAASVHLPLFRFDDVYLGIVALKAG 275
            .:..||| ..|.:.|.....|.  .||:.::..|.|.| :...|..|..:.|||..:|  :...|
plant   260 EEGGKWY-EPEWWKFGDEKSYFRHAAGSLLILSKTLAQYVNINSGSLKTYAFDDTSIG--SWMIG 321

  Fly   276 ISLQHCDDFR 285
            :...:.||.|
plant   322 VQATYIDDNR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 45/206 (22%)
AT2G25300NP_180102.3 DUF4094 30..103 CDD:290073 2/6 (33%)
Galactosyl_T 134..329 CDD:304462 45/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.