DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and si:dkeyp-98a7.1

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001138282.1 Gene:si:dkeyp-98a7.1 / 796449 ZFINID:ZDB-GENE-050208-519 Length:367 Species:Danio rerio


Alignment Length:360 Identity:90/360 - (25%)
Similarity:153/360 - (42%) Gaps:64/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HRKLLLRCLLVLPLILLVDYCGLLTHLHELNFE---------------RH--FHYPLNDDTGSGS 52
            |.|.....||.|..:|     ..:.::.:::||               .|  |:..|:|      
Zfish    21 HIKKAFVLLLTLAFLL-----STIAYMSDVSFEDIKLPHKWLFKVINKTHGVFNQTLDD------ 74

  Fly    53 ASSGLDKFAYL---RVPSFTAEV-----------PVDQP------ARLTMLIKSAVGNSRRREAI 97
               |.|:.|.|   ::..:.|.:           .:|:|      ..|.:::..|......|.||
Zfish    75 ---GKDRLAPLAKQQIQQWGAAIYHVAHPRNYDFMLDEPDVCKENPFLVLMVPVAPNQIDARNAI 136

  Fly    98 RRTWGYEGRFSDVHLRRVFLLG--TAEDSEK---DVAWESREHGDILQAEFTDAYFNNTLKTMLG 157
            |.|||.|.......:..:||:|  ...||||   .:..|||:|.|::|:.|.|:|||.|:|||:.
Zfish   137 RSTWGNETTVQGKAVLTLFLVGLIVGADSEKAQQQLEEESRQHRDLIQSNFVDSYFNLTIKTMVI 201

  Fly   158 MRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSP-LRHKFSKWYV 221
            |.|.:.:..::.:.:.:|.|.:::..|::..|.......  |....|.|....| :|.|.|||||
Zfish   202 MGWLATRCPQANYSMKIDSDMFLNVDNLVTLLSAPNTPR--ENYITGMVMWNRPVVRSKDSKWYV 264

  Fly   222 SLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDD--- 283
            |.|.||...:|.|:....::.|.....::..||.::..|..:|.|:|......|.:.....|   
Zfish   265 SEELYPEPTYPTYLLGMGYVFSNDLPSKIVEASKYVKPFNIEDAYIGACVKHLGYAPTSPPDPSQ 329

  Fly   284 FRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVWNE 318
            ||.:...|...|.:.  :.:...|.|:::..:|.:
Zfish   330 FRAYLGQYVREDFFR--VITTILGSPQQLIDIWKD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 61/195 (31%)
si:dkeyp-98a7.1NP_001138282.1 Galactosyl_T 131..325 CDD:304462 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.