DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GNT4

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_110392.1 Gene:B3GNT4 / 79369 HGNCID:15683 Length:378 Species:Homo sapiens


Alignment Length:297 Identity:97/297 - (32%)
Similarity:138/297 - (46%) Gaps:26/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RHFHYPLNDDTGSGSAS-----------SGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNS 91
            ||...|.|....|.|.|           .....|:.|..||     ...:...|.:.|||..|:.
Human    72 RHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPS-----GCSKDTFLLLAIKSQPGHV 131

  Fly    92 RRREAIRRTWGYEGRFS-DVHLRRVFLLGTAEDS--EKDVAWESREHGDILQAEFTDAYFNNTLK 153
            .||.|||.|||..|.:: ...|:.|||||.|..:  .:.:|:||||..||||.:||:.:||.|||
Human   132 ERRAAIRSTWGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDDILQWDFTEDFFNLTLK 196

  Fly   154 TMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSK 218
            .:...||......::.|.|..|||.:|...|||:||. |....| :||....:.|..|.|:...|
Human   197 ELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLD-GWDPAQ-DLLVGDVIRQALPNRNTKVK 259

  Fly   219 WYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDD 283
            :::....|....:|||...|.:::|:..:|:|.|......||..|||::|:...:.|:|..|...
Human   260 YFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAG 324

  Fly   284 FR---FHRPAYK-GPDSYSSVIASHEFGDPEEMTRVW 316
            |:   ..||... .|..|..::..|.. .|.||..:|
Human   325 FKTFGIRRPLDPLDPCLYRGLLLVHRL-SPLEMWTMW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 71/192 (37%)
B3GNT4NP_110392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81 4/8 (50%)
Galactosyl_T 132..321 CDD:304462 70/190 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156984
Domainoid 1 1.000 131 1.000 Domainoid score I5138
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.