DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3gnt2b

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_991315.2 Gene:b3gnt2b / 793362 ZFINID:ZDB-GENE-050913-158 Length:397 Species:Danio rerio


Alignment Length:274 Identity:85/274 - (31%)
Similarity:135/274 - (49%) Gaps:19/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DKFAYLRVPSFTAEVPVDQP------ARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVF 116
            |...|:|..|:  .:.||||      ..|.:.|||.|.:..||:|||.:||..||.::..:..||
Zfish   117 DFLLYMRCRSY--PIVVDQPNICKKQPFLFLAIKSLVPHFDRRQAIRESWGKVGRIANRSVVTVF 179

  Fly   117 LLGTA--EDSEKDVA----WESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVD 175
            |||.|  ||...|::    .||..|.||||.::.|.:||.|:|.:|.:.|.|.:...:.|....|
Zfish   180 LLGNAATEDHFPDLSKMLHHESSIHRDILQWDYRDTFFNLTIKEVLFLEWLSTRCPGANFIFKGD 244

  Fly   176 DDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAF 240
            ||.:|:..:::.||.....:...||.....:....|.|.|..|:::. |......:|.|...|.:
Zfish   245 DDVFVNTIHIIDFLTNLSNAKARELFVGDVITNAGPHRDKKVKYFIP-ESMFVGMYPAYAGGGGY 308

  Fly   241 ILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPD---SYSSVIA 302
            :.|.:..::|:..|..:||:..||||.|:..:|.|::.:....||......|..|   :|.|::.
Zfish   309 LFSGQLAQRLHNISKLVPLYPIDDVYTGMCLMKMGLAPEKHKGFRTFDIEEKYRDNACAYKSLML 373

  Fly   303 SHEFGDPEEMTRVW 316
            .|. ..|:.|.::|
Zfish   374 VHP-RSPQHMIKIW 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 62/195 (32%)
b3gnt2bNP_991315.2 Galactosyl_T 155..347 CDD:304462 62/192 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592649
Domainoid 1 1.000 126 1.000 Domainoid score I5333
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.