DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and aars2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_001332388.5 Gene:aars2 / 792787 ZFINID:ZDB-GENE-041008-213 Length:1004 Species:Danio rerio


Alignment Length:254 Identity:50/254 - (19%)
Similarity:81/254 - (31%) Gaps:94/254 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 THLHELNFE-RHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSR 92
            |..|.|||. |....|:....||..:::.| :|.:    |....:.|.:..::..|:.:.:    
Zfish   643 TATHVLNFALRELLGPIVSQRGSHCSANRL-RFDF----SVKGTLTVSELQKVEELVLNII---- 698

  Fly    93 RREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLG 157
            |:.|            |||:..|.|     .|.|.:|                           |
Zfish   699 RQNA------------DVHVEEVPL-----SSAKQIA---------------------------G 719

  Fly   158 MRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP--ELLFAGHVFQTSPLRHKFSKWY 220
            :|...:        |:.|....||....:..|....::.|.  ||....|:.:|..:|.     :
Zfish   720 LRTVDE--------LYPDPVRVVSVAVPVSDLLASERAEQTSVELCCGTHLLRTGAIRD-----F 771

  Fly   221 VSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQ 279
            |.:.|                      ||:......:..|..||   .|.|.:||.:||
Zfish   772 VVVSE----------------------RQMMKGVCRIVAFTGDD---AIKAREAGQALQ 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 36/190 (19%)
aars2XP_001332388.5 PLN02900 41..993 CDD:215487 50/254 (20%)
AlaRS_core 44..292 CDD:238360
tRNA_SAD 565..787 CDD:298782 41/231 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.