DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_082465.3 Gene:B3gnt3 / 72297 MGIID:2152535 Length:372 Species:Mus musculus


Alignment Length:322 Identity:99/322 - (30%)
Similarity:151/322 - (46%) Gaps:40/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVD 75
            ||...|.:....|:.||..|:.:..|.||..                 .|..||.|..|   ...
Mouse    60 RCRANLSVSSHPDFAGLPLHVRDFLFYRHCR-----------------DFPVLREPRVT---KCA 104

  Fly    76 QPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKD------VAWESRE 134
            :|..|.:.|||:..|..||:.:|.||..|.|.....|||:||:|:..|.::.      :..|:::
Mouse   105 EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLLELEAQK 169

  Fly   135 HGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPE 199
            :|||||.:|.|::||.|||.:|.:.|.......:.|.|..|||.:....|::.:|    |.|.|:
Mouse   170 YGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVTYL----QDHDPD 230

  Fly   200 L-LFAGHVFQ-TSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRF 262
            . ||.||:.| ..|:|..:||:::.......||:|||...|.|:||:..:..|..|:..||:|..
Mouse   231 QHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVAALRRAARVLPMFPI 295

  Fly   263 DDVYLGIVALKAGISLQHCDDFR-------FHRPAYKGPDSYSSVIASHEFGDPEEMTRVWN 317
            |||:||:...:.|::.......|       ..|.:...|..|..::..|.| .|.||..:|:
Mouse   296 DDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDLLLVHRF-LPFEMLLMWD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 68/197 (35%)
B3gnt3NP_082465.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..56
Galactosyl_T 122..311 CDD:389837 68/192 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847379
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm57814
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3094
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.