DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001102962.1 Gene:B3galt2 / 686081 RGDID:1586615 Length:422 Species:Rattus norvegicus


Alignment Length:293 Identity:80/293 - (27%)
Similarity:147/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPAR-------LTMLIKSAVGNSRRREAIRRTWGY 103
            ::.|:|..:|  ..|.|:          :::|.:       |.:||.:..|....|.|||:|||.
  Rat   124 NEKGTGHPNS--YHFKYI----------INEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGN 176

  Fly   104 EGRFSDVHLRRVFLLGTAED----SEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ 164
            |.....:.:.|:||||.:..    .:..:..||.::.||:|.|:.|.|:|.|:||::||.|.:..
  Rat   177 ETLAPGIQITRIFLLGISIKLNGYLQHAIQEESIQYHDIIQQEYLDTYYNLTIKTLMGMNWVATY 241

  Fly   165 FNRSEFYLFVDDDYYVSAKNVL-KFLGRGRQSHQPEL-----LFAGHVFQ-TSPLRHKFSKWYVS 222
            ...:.:.:..|.|.:|:.:.:: |.|       :|:|     .|.|::.: .:|.|:|.||||:.
  Rat   242 CPHTPYVMKTDSDMFVNTEYLIHKLL-------KPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMP 299

  Fly   223 LEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGIS-LQHCDDFRF 286
            .:.||.:|:|.:.:...::.|.....:::..|:.:.....:|||:||...|..:. :...::|.|
  Rat   300 PDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRVDPVPPPNEFVF 364

  Fly   287 H--RPAYKGPDSYSSVIASHEFGDPEEMTRVWN 317
            :  |.:|.. ..||.:|.||:| .|.|:.:.||
  Rat   365 NHWRVSYSS-CKYSHLITSHQF-QPSELIKYWN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 56/201 (28%)
B3galt2NP_001102962.1 Galactosyl_T 165..359 CDD:250845 56/200 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm44835
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.