DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and si:dkey-160o24.3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_021336785.1 Gene:si:dkey-160o24.3 / 558930 ZFINID:ZDB-GENE-140106-224 Length:459 Species:Danio rerio


Alignment Length:275 Identity:89/275 - (32%)
Similarity:129/275 - (46%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFS--DVHL---RRVFLLGTAE--DSEKDVAWESREHGD 137
            |.:.||:...|...|||||.|||..||..  |..|   |||||||.::  ..|:.:..||:::||
Zfish   185 LLLAIKTQTANFENREAIRETWGRSGRIKTRDGQLKIVRRVFLLGKSKSRQHEEKLQLESKKYGD 249

  Fly   138 ILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFL-------GRGRQS 195
            |||.|||||:||.|||.:|...|.|.:...:.|....|||.:|....||.:|       ....:|
Zfish   250 ILQWEFTDAFFNLTLKDVLFWEWFSRRCPHARFIFKGDDDVFVRTPAVLDYLQAVEANESLSDES 314

  Fly   196 HQPELLFAGHVF-QTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPL 259
            ...|....|.|. ..:|:|...:|:::. |.:....:|.|...|..:.|.....:|...|..:.|
Zfish   315 KNMESFVIGDVIHNAAPIRTNNTKYFIP-ESFFKGLYPSYPGGGGVVYSGSLAHRLLEVSQRVHL 378

  Fly   260 FRFDDVYLGIVALKAGISLQHCDDFRFHRPAY----------KGPDSYSSVIASHEFGDPEEMTR 314
            |..||||||:...:.|:       :..|.||:          |.|.:..:::..|: ..|.||.:
Zfish   379 FPIDDVYLGMCLRRLGV-------YPVHHPAFLTFDFPKDEPKEPCANHTILLVHK-RSPAEMFK 435

  Fly   315 VW-------NECRSA 322
            :|       .|||:|
Zfish   436 LWFETLIPSPECRNA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 71/204 (35%)
si:dkey-160o24.3XP_021336785.1 Galactosyl_T 199..401 CDD:328824 72/209 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.