DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and zgc:162952

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_005171926.1 Gene:zgc:162952 / 555791 ZFINID:ZDB-GENE-070424-98 Length:328 Species:Danio rerio


Alignment Length:314 Identity:67/314 - (21%)
Similarity:109/314 - (34%) Gaps:93/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YC------GLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTM 82
            ||      .|.|.:.:|.|..:|.:.|   .|||..|.     .|..:.:.|.:|         |
Zfish    38 YCHVDRWQKLRTAVRKLEFWENFTHEL---IGSGFFSK-----VYKVIHNTTRKV---------M 85

  Fly    83 LIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAED------------------SEKDVA 129
            ::| ...|...:::|.|......:.|..::.|...:...||                  :.:||.
Zfish    86 VVK-IYKNDVDQDSIVREISLLQKLSHPNIVRYLGICVKEDKLYPILEYVSGGCLEELLARQDVP 149

  Fly   130 WESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYY--VSAKN-VLKFLGR 191
            ...||..|:                      ||| ..|...||...:.|:  :::|| :::...|
Zfish   150 LCWREKVDL----------------------ASD-ITRGMIYLHYKNIYHRDLNSKNCLIRMTAR 191

  Fly   192 GRQSHQPELLFAGHVFQTSPLRHKFSK-----WYV--SLEEYPFDRWPPYVTAGAFILSQKALRQ 249
            ||::...:...|..|.:......|.|.     |..  .|...|:||.....:.|  |:..:.|.:
Zfish   192 GREALVTDFGLAREVVELPSKDRKLSLVGSAFWMAPEMLRGEPYDRKVDVFSFG--IVLCEILAR 254

  Fly   250 LYAASVHLPLFRFDDVYLGIVALKAGIS---------LQHC---DDFRFHRPAY 291
            :.|....||  |..|..|.:.|.:..:|         ...|   |.||  ||::
Zfish   255 IPADPEILP--RTQDYGLDVSAFRKMVSGCPQRLLELAASCCLLDAFR--RPSF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 44/229 (19%)
zgc:162952XP_005171926.1 TyrKc 63..311 CDD:197581 60/289 (21%)
PKc_LIMK_like_unk 65..318 CDD:271058 59/284 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.