DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001162585.1 Gene:B3gnt2 / 53625 MGIID:1889505 Length:397 Species:Mus musculus


Alignment Length:281 Identity:88/281 - (31%)
Similarity:140/281 - (49%) Gaps:19/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DKFAYLRVPSFTAEVPVDQPAR------LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVF 116
            |...|||..:::  :.:|||.:      |.:.|||.:.:..||:|||.:||.|....:..:.|||
Mouse   118 DFLLYLRCRNYS--LLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVF 180

  Fly   117 LLGTA--EDSEKDVA----WESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVD 175
            |||..  ||:..|::    :||.:|.|||...:.|.:||.:||.:|.:||.|.....:||....|
Mouse   181 LLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGD 245

  Fly   176 DDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAF 240
            ||.:|:..::|.:|....:|...:|.....:....|.|.|..|:|:. |.:....:|||...|.|
Mouse   246 DDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIP-EVFYTGVYPPYAGGGGF 309

  Fly   241 ILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFR---FHRPAYKGPDSYSSVIA 302
            :.|.....:||:|:..:.|:..||||.|:...|.|:..:....||   ......|...||..::.
Mouse   310 LYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLML 374

  Fly   303 SHEFGDPEEMTRVWNECRSAN 323
            .|. ..|:||..:|::.:|.|
Mouse   375 VHS-RKPQEMIDIWSQLQSPN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 65/195 (33%)
B3gnt2NP_001162585.1 Galactosyl_T 156..345 CDD:304462 64/189 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm57814
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.