DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3galnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001011210.1 Gene:b3galnt2 / 496641 XenbaseID:XB-GENE-1012156 Length:488 Species:Xenopus tropicalis


Alignment Length:209 Identity:48/209 - (22%)
Similarity:90/209 - (43%) Gaps:29/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSA 182
            |...|..:..:..||....||:.....|.|.|...|.:...:|.: :|...||.|..|||.::..
 Frog   288 LAALEKEDALLQEESTTFQDIVFVHVVDTYRNVPSKLLNFYQWTA-EFTSFEFLLKTDDDCFIDI 351

  Fly   183 KNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKAL 247
            :|||:.:  ..:..|.|..:.|: |:.:....:..||...  ||....:|.:.....:::||..:
 Frog   352 ENVLEKI--AHKQLQKENTWWGN-FRLNWAVDRTGKWQEL--EYLSPAYPAFACGSGYVISQDIV 411

  Fly   248 RQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSY--------SSVIASH 304
            :.|.:.|..|..::.:||.:||.....|.|       |:.       ||:        :.:::|.
 Frog   412 QWLASNSQRLKTYQGEDVSMGIWMSAIGPS-------RYQ-------DSHWLCEKKCEAGMLSSP 462

  Fly   305 EFGDPEEMTRVWNE 318
            :: .|:|:..:|.:
 Frog   463 QY-TPQELLELWQQ 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 41/163 (25%)
b3galnt2NP_001011210.1 Galactosyl_T 292..445 CDD:304462 41/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.