DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment brn and irak1

DIOPT Version :9

Sequence 1:	NP_476901.1	Gene:	brn / 31358	FlyBaseID:	FBgn0000221	Length:	325	Species:	Drosophila melanogaster
Sequence 2:	XP_012823676.1	Gene:	irak1 / 448357	XenbaseID:	XB-GENE-488193	Length:	760	Species:	Xenopus tropicalis

Alignment Length:	50	Identity:	15/50 - (30%)
Similarity:	29/50 - (57%)	Gaps:	2/50 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 VLPLILLVDYCGLLTHLHELNFE-RHFHYPLNDDTGSGSASSGLDKFAYL 63
            |||.:.:.|....:.:.::|..: |..|| .|:.:||||::||..:..::
Frog   657 VLPRVSVQDPIPPVQYQNQLAVQPRQRHY-CNELSGSGSSTSGASQAIFV 705

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
brn	NP_476901.1	Galactosyl_T	92..282	CDD:250845
irak1	XP_012823676.1	Death_IRAK1	9..94	CDD:260061
irak1	XP_012823676.1	STKc_IRAK1	223..521	CDD:271061
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2287
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000088
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X41
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.900