powered by:
Protein Alignment brn and irak1
DIOPT Version :9
Sequence 1: | NP_476901.1 |
Gene: | brn / 31358 |
FlyBaseID: | FBgn0000221 |
Length: | 325 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012823676.1 |
Gene: | irak1 / 448357 |
XenbaseID: | XB-GENE-488193 |
Length: | 760 |
Species: | Xenopus tropicalis |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 29/50 - (57%) |
Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VLPLILLVDYCGLLTHLHELNFE-RHFHYPLNDDTGSGSASSGLDKFAYL 63
|||.:.:.|....:.:.::|..: |..|| .|:.:||||::||..:..::
Frog 657 VLPRVSVQDPIPPVQYQNQLAVQPRQRHY-CNELSGSGSSTSGASQAIFV 705
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2287 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000088 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X41 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.900 |
|
Return to query results.
Submit another query.