DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3galt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_996984.1 Gene:b3galt2 / 404633 ZFINID:ZDB-GENE-040426-2078 Length:437 Species:Danio rerio


Alignment Length:251 Identity:78/251 - (31%)
Similarity:131/251 - (52%) Gaps:15/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDS--EKDVAWESREHGDILQAE 142
            |.:||.:.......|.|||:|||.|.........|:||||...::  :..|..||.:|.||:|.:
Zfish   165 LVLLIAAEPRQLEARNAIRQTWGNESVAMGYGFVRLFLLGRIPNAYPQSSVDEESLQHHDIIQQD 229

  Fly   143 FTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGR----GRQSHQPELLFA 203
            |.|.|:|.|:||::||.|.:.....:.:.:..|.|.:|:.:.:::.|.:    .||::....|..
Zfish   230 FLDTYYNLTIKTLMGMSWVARYCPHARYVMKTDSDMFVNTEYLIQKLLKPNTAPRQNYFTGYLMR 294

  Fly   204 GHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLG 268
            |:    :|.|:|.||||:..|.|..:|:|.:.:...::.|.....::|.||:.:.....:|||:|
Zfish   295 GY----APNRNKDSKWYMPPELYSIERYPIFCSGTGYVFSGDMAAKIYNASLSIRRLHLEDVYVG 355

  Fly   269 IVALKAGIS-LQHCDDFRFH--RPAYKGPDSYSSVIASHEFGDPEEMTRVWNECRS 321
            |...|..|. :...::|.|:  |.:|.. ..||.:|.||:| .|.|:.:.||..:|
Zfish   356 ICLAKLRIDPVPPPNEFLFNHWRVSYSS-CKYSHLITSHQF-QPNELMKYWNHLQS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 60/196 (31%)
b3galt2NP_996984.1 Galactosyl_T 177..369 CDD:250845 60/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592618
Domainoid 1 1.000 126 1.000 Domainoid score I5333
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.