DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GNT8

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001372577.1 Gene:B3GNT8 / 374907 HGNCID:24139 Length:397 Species:Homo sapiens


Alignment Length:278 Identity:79/278 - (28%)
Similarity:119/278 - (42%) Gaps:30/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLR 113
            |.||..|...          ..:||.     |.:.:||..|....|:|:|.|||...    ..:|
Human   134 GGGSQVSSCS----------DTDVPY-----LLLAVKSEPGRFAERQAVRETWGSPA----PGIR 179

  Fly   114 RVFLLGT-----AEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLF 173
            .:||||:     ..|.:..||||||.:.|:|..:|.|..||.|||.:|.:.|.........|.|.
Human   180 LLFLLGSPVGEAGPDLDSLVAWESRRYSDLLLWDFLDVPFNQTLKDLLLLAWLGRHCPTVSFVLR 244

  Fly   174 VDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVF-QTSPLRHKFSKWYVSLEEYPFDRWPPYVTA 237
            ..||.:|....:|..| |.........|:.|.|| |..|||.....:||. |.:....:|.|.:.
Human   245 AQDDAFVHTPALLAHL-RALPPASARSLYLGEVFTQAMPLRKPGGPFYVP-ESFFEGGYPAYASG 307

  Fly   238 GAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPD--SYSSV 300
            |.::::.:....|..|:..:..|.|:|||.|:.....|:..|....|....||.:..|  ::.::
Human   308 GGYVIAGRLAPWLLRAAARVAPFPFEDVYTGLCIRALGLVPQAHPGFLTAWPADRTADHCAFRNL 372

  Fly   301 IASHEFGDPEEMTRVWNE 318
            :.....| |:...|:|.:
Human   373 LLVRPLG-PQASIRLWKQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 61/195 (31%)
B3GNT8NP_001372577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Galactosyl_T 162..349 CDD:419759 60/192 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.