DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and beta3GalTII

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster


Alignment Length:297 Identity:66/297 - (22%)
Similarity:108/297 - (36%) Gaps:80/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSFTAEVPVDQP---ARLTMLIKSAVGNSRRREAIRRTW-----------------------GYE 104
            |:..:.:|..:|   ..|.:|:.||..|:..|.|:||||                       ..:
  Fly    34 PAHRSRIPHLEPHPNLFLMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQ 98

  Fly   105 GRFSD-------------------------------VHLRRVFLLGTAEDSEKDVA---WESREH 135
            |....                               :.::.||.:||.:.|...:|   .|..::
  Fly    99 GHLQVELVAEQASRLRQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQN 163

  Fly   136 GDILQA-EFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYV---SAKNVL----KFLGRG 192
            .|:|.. ...|.|.|.|.|.|..:......:..| :.|.||||.||   |..|.|    :.|.|.
  Fly   164 NDLLLLNRHHDTYKNLTAKLMQSLYILRRHYEFS-YMLKVDDDTYVKLDSLVNTLVSYDRKLLRK 227

  Fly   193 RQSHQPEL---LFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAAS 254
            |..::..:   |:.|:....|.::.| .:|..| ..|....:.||...|.::||:.....:...|
  Fly   228 RSEYRDHVLPQLYWGYFNGRSTIKTK-GQWKES-SYYLSKNYLPYALGGGYVLSRSLCDYIVNNS 290

  Fly   255 VHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAY 291
            ..|..:..:||.:|...    ..|:|.  :|:|.|.:
  Fly   291 QLLSHYGSEDVSVGTWL----APLRHV--YRWHDPRF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 55/257 (21%)
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 50/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.