DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and CG8673

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster


Alignment Length:416 Identity:92/416 - (22%)
Similarity:160/416 - (38%) Gaps:120/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLRCLLVLPLILL--------------VDY-----------------CGLLTHLHELNFERHFHY 42
            ||||:|:|.|:..              |||                 .|....|      |.|..
  Fly     5 LLRCILILILVSFTVFTYVSKVGVMEKVDYFTTAKPDVMSKNPAIQLVGEAIRL------RSFRE 63

  Fly    43 PLND-DTG-----SGSASSG--------------LDKFAYLR----------------------- 64
            |:.| |.|     ||::|.|              .|..|.:|                       
  Fly    64 PIKDFDDGFAVQISGNSSEGNKDIYTTIDGNINVADSIAAIRSRRIDEEKLHDDGLDSKDILAKK 128

  Fly    65 ---VPSFTAEVPVDQP---------------------------ARLTMLIKSAVGNSRRREAIRR 99
               :.|...||||..|                           .:|.:||.|::.:|..|.:||:
  Fly   129 SVVLYSIDTEVPVRMPLVKTIYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQ 193

  Fly   100 TWGYEGRFSDVHLRRVFLLGTAEDS--EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWAS 162
            ||.:.|...||.:  .|:||..::.  :|.:..|...:.|:::..|.|:|.|.||||:..:.||.
  Fly   194 TWMHYGSRRDVGM--AFVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWAD 256

  Fly   163 DQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYP 227
            ....::::.|..|||.:::...:|..:...:.:   ..::........|:|:::||:::|..:|.
  Fly   257 LHCPKAKYVLKTDDDMFINVPKLLTLISTLKAN---RTIYGRRAENWKPIRNRWSKYHISNAQYG 318

  Fly   228 FDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVY-LGIVALKAGISLQHCDDFRFHRPAY 291
            ...:|.:.|..|::|:...:..||..|::....:.:||: .||||....|...:..:....|..:
  Fly   319 KPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVREMANTRTKF 383

  Fly   292 KGPDSYSSVIASHEFGDPEEMTRVWN 317
            : .......|..|...:.|:.| :||
  Fly   384 E-TCHIRDKITIHMVRNNEQFT-LWN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 49/192 (26%)
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
98.750

Return to query results.
Submit another query.