DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt7

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001012134.1 Gene:B3gnt7 / 316583 RGDID:1310580 Length:397 Species:Rattus norvegicus


Alignment Length:256 Identity:87/256 - (33%)
Similarity:131/256 - (51%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVH---LRRVFLLGTAEDSEKD------VAWESREH 135
            |.:::||.:....|||.||:|||:|...:...   :|.:||||||...|:.      :|:|.|.:
  Rat   132 LLVVVKSVITQHDRREVIRQTWGHEWESAGPDRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLY 196

  Fly   136 GDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP-E 199
            |||||.:|.|::||.|||.:..::|.........|....|||.:|:..|:|:||    ...|| |
  Rat   197 GDILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFIFKGDDDVFVNPTNLLEFL----SDRQPQE 257

  Fly   200 LLFAGHVFQ-TSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFD 263
            .||.|.|.: ..|:|.|.:|:|:....|....:|||...|.|::|....|||:.|...|.||..|
  Rat   258 NLFVGDVLKHARPIRKKDNKYYIPAVMYSKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPID 322

  Fly   264 DVYLGIVALKAGISLQHCDDFR-FHRPAYKG------PDSYSSVIASHEFGDPEEMTRVWN 317
            ||:||:.....|:.....:.|: |.....:|      |..|.|::..|:. .|.|:..:|:
  Rat   323 DVFLGMCLEVLGVKPTGHEGFKTFGISRVRGSRMNKEPCFYRSMLVVHKL-LPAELLAMWD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 74/200 (37%)
B3gnt7NP_001012134.1 Galactosyl_T 144..338 CDD:304462 74/197 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350945
Domainoid 1 1.000 132 1.000 Domainoid score I4969
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm63534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.