DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and CG3038

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_569833.1 Gene:CG3038 / 30970 FlyBaseID:FBgn0040373 Length:388 Species:Drosophila melanogaster


Alignment Length:307 Identity:80/307 - (26%)
Similarity:147/307 - (47%) Gaps:28/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERH----FHYPLNDDTGSGSASS------ 55
            |:.:.|: ||..:|.|.||:|:..|....||.:.:..|.    .|.||.......:.::      
  Fly     1 MRMRGRR-LLPIILSLLLIVLLSLCYFSNHLRDSSQSRKNGFLLHLPLETKRNPSNPNTPLSNLL 64

  Fly    56 GLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGT 120
            .|..|.||...:...:...:..|  .:::.|..|:...|.|.|:... :.:..::.|||||||..
  Fly    65 NLTDFHYLLASNVCRKAKRELLA--VLIVTSYAGHDALRSAHRQAIP-QSKLEEMGLRRVFLLAA 126

  Fly   121 AED-----SEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNR-SEFYLFVDDDYY 179
            ...     |:..:|.|....||:||..|.:.|.|.:.|.::|::|.|::..: ::|.:.:|||..
  Fly   127 LPSREHFISQDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLKWVSEECKKQAKFIIKLDDDII 191

  Fly   180 VSAKNVLKFLGRGRQSHQPEL-----LFAGHVFQTS-PLRHKFSKWYVSLEEYPFDRWPPYVTAG 238
            ....::.::| ...:..:|.|     |.:|:|.... |:|.:.:|||||.:|||...:|.|::..
  Fly   192 YDVFHLRRYL-ETLEVREPGLATSSTLLSGYVLDAKPPIRLRANKWYVSKKEYPQALYPAYLSGW 255

  Fly   239 AFILSQKALRQLYAASVHLPLFRFDDVYL-GIVALKAGISLQHCDDF 284
            .::.:.....::.|.:..:..|..||.:| |:|..:.||.|:..:|:
  Fly   256 LYVTNVPTAERIVAEAERMSFFWIDDTWLTGVVRTRLGIPLERHNDW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 56/202 (28%)
CG3038NP_569833.1 Galactosyl_T 103..297 CDD:304462 54/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm47879
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
87.970

Return to query results.
Submit another query.