DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt8

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001100962.1 Gene:B3gnt8 / 308440 RGDID:1305374 Length:389 Species:Rattus norvegicus


Alignment Length:288 Identity:86/288 - (29%)
Similarity:129/288 - (44%) Gaps:40/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPLNDDTGSGS-ASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEG 105
            :||....|.|| .:|..||           :||.     |.:.:||..|:...|:|:|.|||   
  Rat   119 FPLWLPAGEGSPVASCSDK-----------DVPY-----LLLAVKSEPGHFAARQAVRETWG--- 164

  Fly   106 RFSDV-HLRRVFLLGT-----AEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ 164
              |.| ..|.:||||:     ..|....|.||||.:||:|..:|.|..:|.|||.:|.:.|.|..
  Rat   165 --SPVAGTRLLFLLGSPLGMGGPDLTSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHH 227

  Fly   165 FNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP---ELLFAGHVF-QTSPLRHKFSKWYVSLEE 225
            ..:..|.|.|.|:.:|....:|:.|    |:..|   ..|:.|.|| |..|||.....:||....
  Rat   228 CPKVSFVLQVQDNAFVHIPALLEHL----QALPPTWARSLYLGEVFTQAKPLRKPGGPFYVPKTF 288

  Fly   226 YPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPA 290
            :..| :|.|.:.|.:::|.:....|..|:..:..|.|||||.|......|::.:....|....||
  Rat   289 FEGD-YPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAPRAHPGFLTAWPA 352

  Fly   291 --YKGPDSYSSVIASHEFGDPEEMTRVW 316
              .:.|.:...::..|.. .|::...:|
  Rat   353 ERTRDPCAVRGLLLVHPV-SPQDTIWLW 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 65/199 (33%)
B3gnt8NP_001100962.1 Galactosyl_T 154..341 CDD:419759 65/196 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.