DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001100710.1 Gene:B3gnt2 / 305571 RGDID:1310077 Length:397 Species:Rattus norvegicus


Alignment Length:281 Identity:87/281 - (30%)
Similarity:138/281 - (49%) Gaps:19/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DKFAYLRVPSFTAEVPVDQPAR------LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVF 116
            |...|||..:::  :.:|||.:      |.:.|||.:.:..||:|||.:||.|....:..:.|||
  Rat   118 DFLLYLRCRNYS--LLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVF 180

  Fly   117 LLGTA--EDSEKDVA----WESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVD 175
            |||..  ||:..|::    :||.:|.|||...:.|.:||.:||.:|.:||.|.....:||....|
  Rat   181 LLGKTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGD 245

  Fly   176 DDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAF 240
            ||.:|:..::|.:|....:|...:|.....:....|.|.|..|:|:. |.:....:|||...|.|
  Rat   246 DDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIP-EVFYTGVYPPYAGGGGF 309

  Fly   241 ILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFR---FHRPAYKGPDSYSSVIA 302
            :.|.....:||..:..:.|:..||||.|:...|.|:..:....||   ......|...||..::.
  Rat   310 LYSGPLALRLYNVTDRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLML 374

  Fly   303 SHEFGDPEEMTRVWNECRSAN 323
            .|. ..|:||..:|::.:|.|
  Rat   375 VHS-RKPQEMIDIWSQLQSPN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 64/195 (33%)
B3gnt2NP_001100710.1 Galactosyl_T 156..345 CDD:419759 63/189 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350942
Domainoid 1 1.000 132 1.000 Domainoid score I4969
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm63534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.