DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt9

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_008770778.1 Gene:B3gnt9 / 291958 RGDID:1310170 Length:398 Species:Rattus norvegicus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:117/270 - (43%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GSASSGLDKFAYLRVPSFTAEVPV--------------------------DQPAR---------- 79
            |..:..|...|:...|::..|.||                          :||.:          
  Rat    52 GRRALELPNTAHAAPPAYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHSDGASGGS 116

  Fly    80 --LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVA-----W------E 131
              |.:.:||...:..||||:|:|||.|||.....:|||||||..:.:....|     |      |
  Rat   117 LDLLIAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRTHWRALLEAE 181

  Fly   132 SREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSH 196
            ||.:.|||...|.|.:||.|||.:..:.|||.......|....|.|.:|..:|:|:||    :..
  Rat   182 SRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFL----EPR 242

  Fly   197 QP--ELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPL 259
            .|  :||....:.|..|:|.:.||:::....|....:|.|...|.|:||...|.:|..|...:.|
  Rat   243 DPAQDLLAGDVIVQARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAHACTQVEL 307

  Fly   260 FRFDDVYLGI 269
            |..|||:||:
  Rat   308 FPIDDVFLGM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 69/191 (36%)
B3gnt9XP_008770778.1 Galactosyl_T 131..330 CDD:304462 69/191 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350946
Domainoid 1 1.000 132 1.000 Domainoid score I4969
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.