DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001138323.1 Gene:B3galnt2 / 291212 RGDID:1306946 Length:504 Species:Rattus norvegicus


Alignment Length:195 Identity:41/195 - (21%)
Similarity:74/195 - (37%) Gaps:31/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQS 195
            ||..:.||:..:..|.|.|...|.:...||..:..:.| ..|..|||.|:..:.|...:.: :..
  Rat   315 ESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVESTSFS-LLLKTDDDCYIDLEAVFNRIAQ-KNL 377

  Fly   196 HQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLF 260
            ..|...:..  |:.:....:..||...  |||...:|.:.....:::|:..:..|...|..|..:
  Rat   378 DGPNFWWGN--FRLNWAVDRTGKWQEL--EYPSPAYPAFACGSGYVISKDIVDWLAGNSGRLKTY 438

  Fly   261 RFDDVYLGIVALKAG---------ISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVW 316
            :.:||.:||.....|         :..:.|:......|.|                .|||::::|
  Rat   439 QGEDVSMGIWMAAIGPKRHQDSLWLCEKTCETGMLSSPQY----------------SPEELSKLW 487

  Fly   317  316
              Rat   488  487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 34/159 (21%)
B3galnt2NP_001138323.1 Galactosyl_T 309..459 CDD:304462 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.