DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001099538.1 Gene:B3gnt3 / 290638 RGDID:1305151 Length:378 Species:Rattus norvegicus


Alignment Length:320 Identity:96/320 - (30%)
Similarity:147/320 - (45%) Gaps:62/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAV 88
            :..|.:|:.:....||..                 .||.||.|..|   ...|||.|.:.|||:.
  Rat    70 FARLPSHVRDFLLYRHCR-----------------DFAVLREPKAT---KCAQPAFLLLAIKSSP 114

  Fly    89 GNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKD------VAWESREHGDILQAEFTDAY 147
            .|..||:.:|.||..|.|.....|||:||:|:..|.::.      :..|::.:|||||.:|.|::
  Rat   115 ANYGRRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSF 179

  Fly   148 FNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFL-GRGRQSHQPELLFAGHVFQ-TS 210
            ||.|||.:|.:.|.......:.|.|..|||.:....|::.:| ||....|    ||.||:.| ..
  Rat   180 FNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQH----LFVGHLIQNVG 240

  Fly   211 PLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAG 275
            |:|..:||:::.......|::|||...|.|:||:..:..|:.|:..||:|..|||:||:...:.|
  Rat   241 PIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFLGMCLQQQG 305

  Fly   276 ISLQHCDDFRFHRP-AYKG-----------------PDSYSSVIASHEFGDPEEMTRVWN 317
            ::           | |:.|                 |..|..::..|.| .|.||..:|:
  Rat   306 LA-----------PGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRF-LPFEMLLMWD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 67/197 (34%)
B3gnt3NP_001099538.1 Galactosyl_T 119..308 CDD:419759 67/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350933
Domainoid 1 1.000 132 1.000 Domainoid score I4969
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm63534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.