DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galt5

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001099357.1 Gene:B3galt5 / 288161 RGDID:1306727 Length:308 Species:Rattus norvegicus


Alignment Length:275 Identity:82/275 - (29%)
Similarity:136/275 - (49%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEK 126
            :|::|....:   .:|..|.:|:.|:......|.|||:|||.|.......:|..||||:: ||.:
  Rat    42 FLQLPEIDCK---QKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQPVRTFFLLGSS-DSTE 102

  Fly   127 DV---AWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKF 188
            |:   |.||.:|.||:|.:|.|||||.|||||:||.|......::.:.:..|.|.:|:...:.:.
  Rat   103 DMDATALESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTEL 167

  Fly   189 LGRGRQSHQPELLFAGHVF-QTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYA 252
            |   .:.::....|.|::. ...|:|.||:||:||..|||:||:||:.:...::.|.....|:|.
  Rat   168 L---LKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYN 229

  Fly   253 ASVHLPLFRFDDVYLGIVALK----------------AGISLQHCDDFRFHRPAYKGPDSYSSVI 301
            .|..:|..:.:||::|:...|                .|:....|   ||.:           ::
  Rat   230 VSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVC---RFQK-----------IV 280

  Fly   302 ASHEFGDPEEMTRVW 316
            |.| |..|:::...|
  Rat   281 ACH-FMKPQDLLTYW 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 68/209 (33%)
B3galt5NP_001099357.1 Galactosyl_T 69..259 CDD:304462 67/193 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm63534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.