DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3gnt7

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_958451.1 Gene:b3gnt7 / 286748 ZFINID:ZDB-GENE-021210-4 Length:418 Species:Danio rerio


Alignment Length:256 Identity:79/256 - (30%)
Similarity:127/256 - (49%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSE------KDVAWESREHGDI 138
            |.::|||.:....|||.||:|||.|...:...::.:||||.:.:.|      |.:.:|...:||.
Zfish   155 LLIVIKSVITQFDRREVIRKTWGKEQVLNGKRIKTLFLLGKSSNLEERANHQKLLEYEDYIYGDT 219

  Fly   139 LQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFA 203
            ||.:|.|::||.|||.:..::|.|....::::....|||.:||..|:.::|   ..|...:.||.
Zfish   220 LQWDFMDSFFNLTLKEIHFLKWFSSYCPKTQYIFKGDDDVFVSVPNIFEYL---EISGNLKDLFV 281

  Fly   204 GHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYL 267
            |.| |:..|:|.:.:|:|:....|....:|||...|.|::.....|:||.|...|.|:..|||:|
Zfish   282 GDVLFKAKPIRKEQNKYYIPQALYNKTLYPPYAGGGGFLMDGALARKLYGACETLELYPIDDVFL 346

  Fly   268 GIV------------ALKAGISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVW 316
            |:.            |.|. ..|......|.:|.    |..:.|:|..|:...|:.|: :|
Zfish   347 GMCLEVLQVTPIKHNAFKT-FGLVKNKTSRLNRE----PCFFKSLIVVHKLLPPDLMS-MW 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 66/208 (32%)
b3gnt7NP_958451.1 Galactosyl_T 167..358 CDD:304462 63/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.