DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galnt1

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_064410.1 Gene:B3galnt1 / 26879 MGIID:1349405 Length:331 Species:Mus musculus


Alignment Length:253 Identity:73/253 - (28%)
Similarity:122/253 - (48%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLG-TAEDSEKDVAWESRE----HGDIL 139
            |.:|:.|...:.:.|:|||.|||.:..:....:...|||| .||..:|.:|....:    :|||:
Mouse    80 LVILVTSRPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQQAEREDKTLALSLEDEHVLYGDII 144

  Fly   140 QAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAG 204
            :.:|.|.|.|.||||::..||..:....:::.:..|.|.:::..|::|:|   ...:..|..|.|
Mouse   145 RQDFLDTYNNLTLKTIMAFRWVMEFCPNAKYIMKTDTDVFINTGNLVKYL---LNLNHSEKFFTG 206

  Fly   205 H-VFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLG 268
            : :......|..|.|.::|.:||||..:|||.:...:|:|...:.::|....|:...:|:|||:|
Mouse   207 YPLIDNYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVG 271

  Fly   269 IV--ALKAGISLQ-----------HCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMT 313
            |.  .||..|.:.           |.|..:..|           |||:|.|...|.:|
Mouse   272 ICLNLLKVDIHIPEDTNLFFLYRIHLDVCQLRR-----------VIAAHGFSSKEIIT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 61/208 (29%)
B3galnt1NP_064410.1 Galactosyl_T 92..285 CDD:250845 60/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847384
Domainoid 1 1.000 126 1.000 Domainoid score I5388
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.