DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_064409.3 Gene:B3galt2 / 26878 MGIID:1349461 Length:422 Species:Mus musculus


Alignment Length:293 Identity:82/293 - (27%)
Similarity:148/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPAR-------LTMLIKSAVGNSRRREAIRRTWGY 103
            ::.|:|..:|  ..|.|:          :::|.:       |.:||.:..|....|.|||:|||.
Mouse   124 NEKGTGHPNS--YHFKYI----------INEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGN 176

  Fly   104 EGRFSDVHLRRVFLLGTAED----SEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ 164
            |.....:.:.||||||.:..    .:..:..|||::.||:|.|:.|.|:|.|:||::||.|.:..
Mouse   177 ETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATY 241

  Fly   165 FNRSEFYLFVDDDYYVSAKNVL-KFLGRGRQSHQPEL-----LFAGHVFQ-TSPLRHKFSKWYVS 222
            ...:.:.:..|.|.:|:.:.:: |.|       :|:|     .|.|::.: .:|.|:|.||||:.
Mouse   242 CPHTPYVMKTDSDMFVNTEYLIHKLL-------KPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMP 299

  Fly   223 LEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGIS-LQHCDDFRF 286
            .:.||.:|:|.:.:...::.|.....:::..|:.:.....:|||:||...|..:. :...::|.|
Mouse   300 PDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRVDPVPPPNEFVF 364

  Fly   287 H--RPAYKGPDSYSSVIASHEFGDPEEMTRVWN 317
            :  |.:|.. ..||.:|.||:| .|.|:.:.||
Mouse   365 NHWRVSYSS-CKYSHLITSHQF-QPSELIKYWN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 58/201 (29%)
B3galt2NP_064409.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..110
Galactosyl_T 165..359 CDD:250845 58/200 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.