DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and pvg3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_595999.1 Gene:pvg3 / 2540827 PomBaseID:SPBC1921.06c Length:378 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:38/175 - (21%)
Similarity:65/175 - (37%) Gaps:58/175 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DQPARLTMLIKSAVGNSRRREAIRRTWG-YEGRFS---DVHLRRVFLLGTAEDSEK--DVAWESR 133
            |:|.:|.:.|.|...|..||..:|..:. |...|:   .|.:|  |:||..|:.::  .:..|.|
pombe    61 DRPFKLYLGIFSQAKNVDRRNFLRTDYNEYIKEFAVNDTVDVR--FILGLPENEQELATIREEQR 123

  Fly   134 EHGDI-----------------------------LQAEFTD------------AYFNNTLKT--M 155
            .:||:                             |.:|..|            ..:|.::||  :
pombe   124 TYGDLAVLPIPENVDAGKSIVYFQTFLEGYQPFPLFSELADNLIMPSTQFHGSFIYNQSIKTYEL 188

  Fly   156 LGMRWASDQFNRSEFYLFV---DDDYYVSAKNVLKFL----GRGR 193
            .||:...|.......|.|:   |||.:::...:.:.|    |:.|
pombe   189 PGMKEFQDLGEPKHDYDFIVKADDDSFLNLPRLFEMLKEHVGKSR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 32/158 (20%)
pvg3NP_595999.1 Galactosyl_T 103..282 CDD:304462 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.