DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and CG30037

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:123/285 - (43%) Gaps:68/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ARLTMLIKSAVGNSRRREAIRRTWG----------------YEGRFSDV---------------- 110
            |.||:.:.|.|.:..||.|||:.||                .:||:.||                
  Fly    88 ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEG 152

  Fly   111 -----HLRRVFLLG---TAEDSEKD-VAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ-F 165
                 .:|.||::|   .|...|.: ||.|::::.|::|..|.|.|.|.|:|.::.::..:.. .
  Fly   153 DSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCL 217

  Fly   166 NRSEFYLFVDDDYYVSAKNVLKFL------------------------GRGRQSHQPELLFAGHV 206
            |.:.||...|||.:|:..|:|.||                        .|.|.:.:.|:::....
  Fly   218 NTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQH 282

  Fly   207 FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYL-GIV 270
            ....|..:|.:|||:....:....:|.|:....::||...:.:||.||:...:...:|::: |:.
  Fly   283 CNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLC 347

  Fly   271 ALKAGISLQHCDDFRFHRPAYKGPD 295
            |.||||...:...||...| |:|.:
  Fly   348 AEKAGIKRTNHPLFRSSYP-YEGDE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 62/256 (24%)
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
98.700

Return to query results.
Submit another query.