DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and T09F5.1

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_506737.1 Gene:T09F5.1 / 188341 WormBaseID:WBGene00011665 Length:325 Species:Caenorhabditis elegans


Alignment Length:308 Identity:64/308 - (20%)
Similarity:112/308 - (36%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LNFERHF--HYPLN--DDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRR 94
            ||..|.|  ||.::  |..||         |.:|.:|.|....|     .:.::..|...:..||
 Worm    45 LNSSRDFGSHYEISFADIQGS---------FEWLYLPKFELNNP-----EILLIATSRPDDFSRR 95

  Fly    95 EAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVAWESRE-HGDILQAEFTDAYFNNTLKTMLGM 158
            .|||:||..:..........|.|....::..:|:.....| :.||:.....|:|.....||:..:
 Worm    96 NAIRKTWMNQKTNQITSFFMVGLSSKTDEKVRDIVMREAELYRDIVVTSLEDSYTKLAFKTLSIL 160

  Fly   159 RWASDQ---------------FNRSEFYLFVD-DDYYVSAKNVLKFLGRGRQSHQPELLFAGHVF 207
            .:|..:               |..:.|..|:| |:|:::..|...:               |::.
 Worm   161 LYAVSKVPSAQLIGRVDGDVLFFPNLFQSFLDKDNYFINTNNSSIY---------------GYIA 210

  Fly   208 QT-SPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDD-VYLGIV 270
            :. .|...|..|....|..:....:..:::...|:|::.|..:|..||.|....:.|| :..|.:
 Worm   211 EEGKPTTSKCCKSRNFLFPFKCSNYLSFLSGPFFLLTRPAAEKLLNASKHRDFHQIDDQLITGQM 275

  Fly   271 ALKAGISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDP-EEMTRVWN 317
            |..||:.       |.:.|..            |.|.:| .:....|:
 Worm   276 ADDAGVK-------RINLPMI------------HMFPEPTNDFVFAWH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 43/208 (21%)
T09F5.1NP_506737.1 Galactosyl_T 93..287 CDD:250845 44/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.