DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and C54C8.3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001361870.1 Gene:C54C8.3 / 183770 WormBaseID:WBGene00008291 Length:226 Species:Caenorhabditis elegans


Alignment Length:204 Identity:49/204 - (24%)
Similarity:93/204 - (45%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LRRVFLLGTAEDS---EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLF 173
            ::.:||:|.....   :|.|..|::.:|||:..:..|.|...|.|::..:.:...:..|.:....
 Worm    14 MKPLFLVGLTPGEYKMKKMVMQEAKLYGDIIVVDMNDNYEELTYKSLAILLYGVSKAPRYQMIGK 78

  Fly   174 VDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSP--LRHKFSKWYVSLEEYPFDRWPPYVT 236
            :|:|.......:.:...:|.....| |...|...|:..  .|.|..:|||....|...::|.||:
 Worm    79 IDEDVMFFPDKLTELYDQGFIDATP-LRIYGLKMQSGANIFRDKTHRWYVPESSYSCSKFPEYVS 142

  Fly   237 AGAFILSQKALRQLYAASVHLPLFRFDDVYL-GIVALKAGISLQHCDDFRFHRPAYKGPDSY--- 297
            ...::::.:|.:|:..::.:....:.:||:| ||:|...|||:::..:|      ||.|...   
 Worm   143 GMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDLGISVKNLPEF------YKYPSDIEES 201

  Fly   298 --SSVIASH 304
              ..|||.|
 Worm   202 NPGDVIAWH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 41/175 (23%)
C54C8.3NP_001361870.1 Galactosyl_T 1..189 CDD:250845 41/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3094
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.