DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B0024.3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_505645.2 Gene:B0024.3 / 181815 WormBaseID:WBGene00007096 Length:254 Species:Caenorhabditis elegans


Alignment Length:85 Identity:20/85 - (23%)
Similarity:32/85 - (37%) Gaps:20/85 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SREHGDILQAEFTDAYFNNTLKTML---------GMRWASDQFNRSEF-----YLFVDDDYYVSA 182
            |..|..|.....|:|...::|...:         ..|:|.::.:.:||     |...:||..:  
 Worm    93 SHAHSPIFSHSLTNALIISSLARPITYDNRQYYWDSRYAQEKISPTEFPVMCEYQIGEDDGQL-- 155

  Fly   183 KNVLKFLGRGRQSHQPELLF 202
            :||....|    ||...|.|
 Worm   156 QNVTFANG----SHARSLFF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 20/85 (24%)
B0024.3NP_505645.2 CX 124..187 CDD:366767 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.