DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GALNT2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_006711812.1 Gene:B3GALNT2 / 148789 HGNCID:28596 Length:586 Species:Homo sapiens


Alignment Length:200 Identity:44/200 - (22%)
Similarity:79/200 - (39%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESREHGDILQAEFTDAYFNNTLKTMLGMRWA--SDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGR 193
            ||..:.||:..:..|.|.|...|.:...||.  :..||   ..|..|||.|:..:.|...:.: :
Human   313 ESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFN---LLLKTDDDCYIDLEAVFNRIVQ-K 373

  Fly   194 QSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLP 258
            ....|...:..  |:.:....:..||...  |||...:|.:.....:::|:..::.|.:.|..|.
Human   374 NLDGPNFWWGN--FRLNWAVDRTGKWQEL--EYPSPAYPAFACGSGYVISKDIVKWLASNSGRLK 434

  Fly   259 LFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSY------------SSVIASHEFGDPEE 311
            .::.:||.:||  ..|.|                ||..|            :.:::|.:: .|.|
Human   435 TYQGEDVSMGI--WMAAI----------------GPKRYQDSLWLCEKTCETGMLSSPQY-SPWE 480

  Fly   312 MTRVW 316
            :|.:|
Human   481 LTELW 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 36/152 (24%)
B3GALNT2XP_006711812.1 Galactosyl_T 307..457 CDD:304462 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.