DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt5

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_446384.1 Gene:B3gnt5 / 116740 RGDID:70955 Length:377 Species:Rattus norvegicus


Alignment Length:260 Identity:80/260 - (30%)
Similarity:132/260 - (50%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QPARLTMLIKSAVGNSRRREAIRRTWGYEGRFS---DVHLRRVFLLGT-----AEDSEKDVAWES 132
            |...|.:.||:|..|..||.|||:|||.|....   :.:::.:|.|||     .::.:|.:.||.
  Rat    85 QDVLLLLFIKTAPENYERRSAIRKTWGNENYVQSQLNANIKILFALGTPHPLKGKELQKRLIWED 149

  Fly   133 REHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQ 197
            :.:.||:|.:|||::.|.|.|.:|...||:.....:.|.:..|||.::...|::::| :|.:...
  Rat   150 QVYHDIIQQDFTDSFHNLTFKFLLQFGWANTFCPHARFLMTADDDIFIHMPNLIEYL-QGLEQVG 213

  Fly   198 PELLFAGHVFQTS-PLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFR 261
            ....:.|||.:.. |:|.|.||:||..|.|.:..:|.|....|:::|.....::|.||..|....
  Rat   214 VRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSNDVAAKIYEASQTLNSSM 278

  Fly   262 F-DDVYLGIVALKAGISLQHCDDFRFHRPAYKG-------PDSYSSVIASHEFGDPEEMTRVWNE 318
            : |||::|:.|.|.|:..|   |..|    :.|       |..|..:|.||  |..:::..:|.|
  Rat   279 YIDDVFMGLCANKVGVVPQ---DHVF----FSGEGKIPYHPCIYEKMITSH--GHSQDLQDLWVE 334

  Fly   319  318
              Rat   335  334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 63/199 (32%)
B3gnt5NP_446384.1 Galactosyl_T 101..298 CDD:304462 63/200 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm63534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.