DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AgaP_AGAP012992

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_003436549.1 Gene:AgaP_AGAP012992 / 11175775 VectorBaseID:AGAP012992 Length:272 Species:Anopheles gambiae


Alignment Length:84 Identity:25/84 - (29%)
Similarity:40/84 - (47%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTM 82
            :|.:...||:|..|.:::...       ||:.:.:.|..|.|.|.|||....||........|::
Mosquito    13 VISIASVCGILICLVQISNRM-------DDSVNQANSELLQKIALLRVEMEQAEQASPSGPLLSI 70

  Fly    83 LIKSAVGNSRRREAIRRTW 101
            :|:||..::..|..||.||
Mosquito    71 VIRSAKQSTTLRRTIRHTW 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 5/10 (50%)
AgaP_AGAP012992XP_003436549.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.