DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galt9

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_038962145.1 Gene:B3galt9 / 103691796 RGDID:9424697 Length:324 Species:Rattus norvegicus


Alignment Length:293 Identity:86/293 - (29%)
Similarity:126/293 - (43%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAI 97
            :||.|...|.|              .|:..|..|    ||...:...|..||.|:.||:.|||.|
  Rat    12 KLNLEPLRHNP--------------SKYYVLSQP----EVCNGKTIFLLSLIFSSPGNATRRELI 58

  Fly    98 RRTWGYEGRFSDVHLRRVFLLG----TAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGM 158
            |:|||.........:..:|.||    .|...|.|.  |::|:.||::..|.|:..|.|||.:...
  Rat    59 RKTWGSVTSVRGYPILTLFALGMPALVATQEELDA--EAQENNDIIEGIFLDSSENQTLKIISMT 121

  Fly   159 RWASDQFNRSEFYLFVDDDYYVSAKNVLKFL--GRGRQSHQPELLFAGHVF-QTSPLRHKFSKWY 220
            :||......:.|.|..|:|.:::...::.:|  .:|    |.|.::.|.|. |..|.|...|:.:
  Rat   122 QWAVAFCPNALFVLKADEDTFINLPGLVDYLLNLKG----QMEGIYLGRVIHQDIPNRDPHSQEF 182

  Fly   221 VSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFR 285
            |.|.|||...:|.|.:..|||:||...|.:.......|:....||::||.|...|::..|...|.
  Rat   183 VPLSEYPEKYYPDYCSGEAFIMSQDVARMMCVVLNEAPIMVPADVFVGICAKSLGLTPSHSSRFS 247

  Fly   286 FHRPAYKGPDSYSSVIASHEFGDPEEMTRVWNE 318
            ..|........|..:..|.|..| .|.:..|.|
  Rat   248 GERHITYNRCCYKFIFTSSEATD-AETSLAWKE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 61/196 (31%)
B3galt9XP_038962145.1 Galactosyl_T 54..242 CDD:419759 60/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.