DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GNT3

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_055071.2 Gene:B3GNT3 / 10331 HGNCID:13528 Length:372 Species:Homo sapiens


Alignment Length:317 Identity:99/317 - (31%)
Similarity:146/317 - (46%) Gaps:42/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DYCGLLTHLHELNFERHF-HYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKS 86
            |:.....|:......||. |:||..|.                .||..|     ||..|.::|||
Human    72 DFATQPQHVQNFLLYRHCRHFPLLQDV----------------PPSKCA-----QPVFLLLVIKS 115

  Fly    87 AVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKD------VAWESREHGDILQAEFTD 145
            :..|..|||.:|||||.|.:...:.||.:||:|||.:..:.      :..|::.||||||.:|.|
Human   116 SPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHD 180

  Fly   146 AYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP-ELLFAGHVFQ- 208
            ::||.|||.:|.::|...:...:.|.|..|||.:....|::.:|    |.|.| ..||.|.:.| 
Human   181 SFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYL----QDHDPGRHLFVGQLIQN 241

  Fly   209 TSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALK 273
            ..|:|..:||:||.......:|:|||...|.|:||:.....|..|:..|.:|..|||:||:....
Human   242 VGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFLGMCLEL 306

  Fly   274 AGISLQHCDDFR---FHRPAYK----GPDSYSSVIASHEFGDPEEMTRVWNECRSAN 323
            .|:........|   ...|:.:    .|..|..::..|.| .|.||..:|:.....|
Human   307 EGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRF-LPYEMLLMWDALNQPN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 70/197 (36%)
B3GNT3NP_055071.2 Galactosyl_T 122..311 CDD:389837 70/192 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156977
Domainoid 1 1.000 131 1.000 Domainoid score I5138
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40700
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3094
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.