DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GALT5

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_149362.2 Gene:B3GALT5 / 10317 HGNCID:920 Length:314 Species:Homo sapiens


Alignment Length:321 Identity:92/321 - (28%)
Similarity:151/321 - (47%) Gaps:42/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLLRCLLVLPLILLVDYCGLLTHLHELN--FERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFT 69
            :|:..|||||..:     | |...::.||  .|:.|.|..:.:              :|::|...
Human    11 RLMYICLLVLGAL-----C-LYFSMYSLNPFKEQSFVYKKDGN--------------FLKLPDTD 55

  Fly    70 AEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDS--EKDVAWES 132
            ..   ..|..|.:|:.|:......|.|||:|||.|.......|:..|||||...:  .|:|..||
Human    56 CR---QTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQES 117

  Fly   133 REHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQ 197
            :.||||:|.:|.|.|:|.|||||:|:.|......::.|.:..|.|.:::...:.:.|   .:.::
Human   118 QRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELL---LKKNR 179

  Fly   198 PELLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFR 261
            ....|.|.: ....|:|..||||:||..|||:||:||:.:...::.|.....|:|..|..:|..:
Human   180 TTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIK 244

  Fly   262 FDDVYLGIVALKAGISLQHCDDFRFHRPA-YKGPDSYS-----SVIASHEFGDPEEMTRVW 316
            .:||::|:...:..|.|:....    :|. :.|...:|     .::|.| |..|..:...|
Human   245 LEDVFVGLCLERLNIRLEELHS----QPTFFPGGLRFSVCLFRRIVACH-FIKPRTLLDYW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 65/192 (34%)
B3GALT5NP_149362.2 Galactosyl_T 75..265 CDD:304462 65/192 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm40700
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.