DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and LOC101732799

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_012808568.1 Gene:LOC101732799 / 101732799 -ID:- Length:323 Species:Xenopus tropicalis


Alignment Length:260 Identity:72/260 - (27%)
Similarity:127/260 - (48%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VDQPAR-------LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTA--EDSEKDVA 129
            :::|.:       |.:||.|...:...|:|:|:||..|.....:.::|:||||.:  .|.|..|.
 Frog    61 IEEPLQCRGEAPFLVLLIPSMPQDVLVRDALRKTWANESLIPGISIKRIFLLGRSFVNDIEISVE 125

  Fly   130 WESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQ 194
            .||....||:|.:|.|.|.|.|:||::|:.|.|....|:.:.:.||.|.:.:...::      |:
 Frog   126 QESSTFHDIVQQDFLDTYHNLTVKTLMGIEWVSRLCPRASYVMKVDADMFFNPWFLV------RR 184

  Fly   195 SHQPEL-----LFAGHVFQTS-PLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAA 253
            ..|||.     .|.|.:.... |.|::.||||:....||...:|.|.:...::.|.....::|..
 Frog   185 ILQPEKPLKLEFFTGLIITIGMPFRNRGSKWYIPYATYPKFFYPYYCSGTGYVFSGDLSPRIYKE 249

  Fly   254 SVHLPLFRFDDVYLGIVALKAGISLQHCDD--FRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVW 316
            ::.|.||.|:||::||...:.|:.:.....  |...|..| ....::.::..|.: .|:|:.::|
 Frog   250 AMGLTLFPFEDVFVGICLERMGVQISKPGGKWFSQERAEY-NRCQFTKLVTDHHY-SPDELLKLW 312

  Fly   317  316
             Frog   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 60/197 (30%)
LOC101732799XP_012808568.1 Galactosyl_T 88..274 CDD:419759 60/191 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm47879
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.