DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3galt5.4

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_002938781.1 Gene:b3galt5.4 / 100494986 XenbaseID:XB-GENE-1013344 Length:350 Species:Xenopus tropicalis


Alignment Length:322 Identity:87/322 - (27%)
Similarity:147/322 - (45%) Gaps:35/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLRCLLVLPLIL-LVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAE 71
            ||:.|.....|:| |.|:|.:...:        |:.|        |..|...:..:...|....|
 Frog    48 LLIFCFGFCVLLLNLQDFCTICGKI--------FYSP--------SLRSATVRETFQLRPKIQCE 96

  Fly    72 VPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLL--GTAEDSEKDVAWESRE 134
               ..|..|.:|:.:.......|..||:|||.|....|..:...|||  ||....:.::..||..
 Frog    97 ---RNPPFLVLLVTTTHSQKEERNVIRQTWGKERLIGDKLVSSYFLLGAGTNPHLQGELIEESNT 158

  Fly   135 HGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPE 199
            :.||:|.:|.|.|:|.||||::|:.|......::.|.:..|.|.:|:...:::.|.:..|:..  
 Frog   159 YNDIIQRDFIDTYYNLTLKTIMGVEWICTYCPQTTFVMKTDTDMFVNTLYLVELLIKKNQTTD-- 221

  Fly   200 LLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFD 263
             .|.|.: ....|:|...||||::.:|:|..::||:.:...::.|....:::...|..:|.|:.:
 Frog   222 -FFTGSLRLDDGPVRDINSKWYINEKEFPGTKYPPFCSGTGYVFSVDVAQKIQNVSSTVPFFKLE 285

  Fly   264 DVYLGIVALKAGISLQ--HCDDFRFHRPAYKGP---DSYSSVIASHEFGDPEEMTRVWNECR 320
            ||::|:...|..|:||  |.:. .||  .||.|   .:|..::.||.. .|.|:...|...|
 Frog   286 DVFVGMCLEKVKINLQNLHTEP-TFH--IYKKPFTVCNYRKLVTSHGV-RPRELYLYWEALR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 58/194 (30%)
b3galt5.4XP_002938781.1 Galactosyl_T 116..304 CDD:304462 57/190 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm72275
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.