DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3galt5.1

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_002938778.1 Gene:b3galt5.1 / 100494507 XenbaseID:XB-GENE-992040 Length:314 Species:Xenopus tropicalis


Alignment Length:321 Identity:86/321 - (26%)
Similarity:150/321 - (46%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLRCLLVLPLIL-LVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAE 71
            ||:.|.....|:| |.|:|.:.        .:..:.|        |..|...:..:...|....|
 Frog    12 LLIFCFGFCVLLLNLQDFCTIC--------RKRIYSP--------SLRSATVRETFQLRPKIQCE 60

  Fly    72 VPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDS--EKDVAWESRE 134
               ..|..|.:|:.:.......|..||:|||.|....|..:...||||...:.  :.::..||..
 Frog    61 ---RNPPFLVLLVTTTHSQKEARNVIRQTWGKERLIGDKLVSTYFLLGAGTNPRLQGELTGESNT 122

  Fly   135 HGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPE 199
            :.||:|.:|.|:|:|.||||::|:.|......::.|.:..|.|.:|:...:::.|.:..|:..  
 Frog   123 YNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTTFVMKTDTDMFVNPLYLVELLVKKNQTTD-- 185

  Fly   200 LLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFD 263
             :|.|.: ...:|:|:..||:|:|..|||..::||:.:...::.|....:::...|..:|.|:.:
 Frog   186 -VFTGSLRLHDAPIRNNHSKYYISTTEYPLAKYPPFCSGTGYVFSVDVAQKIQNVSSTVPFFKLE 249

  Fly   264 DVYLGIVALKAGISLQHCDDF-RFHRPAYKGP---DSYSSVIASHEFGDPEEMTRVWNECR 320
            ||::|:...|..|:||:.... .||  |||.|   .:|..::.||.. .|.|:...|:..|
 Frog   250 DVFVGMCLEKVNINLQNLHTKPTFH--AYKKPFTICNYRKLVTSHGV-RPRELYLFWDVLR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 57/192 (30%)
b3galt5.1XP_002938778.1 Galactosyl_T 78..268 CDD:389837 57/192 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.