DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and vip

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_002936422.2 Gene:vip / 100489359 XenbaseID:XB-GENE-988257 Length:202 Species:Xenopus tropicalis


Alignment Length:109 Identity:26/109 - (23%)
Similarity:44/109 - (40%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLR 113
            |..||...|:.....||.:...|..|........:........|::.|:::           :|.
 Frog   101 GQLSARRYLESLIGKRVSNNVVEDQVPVKRHSDAVFTDNYSRFRKQMAVKK-----------YLN 154

  Fly   114 RVFLLGTAEDSEKDVAWES-REHGDILQAEFTDAYFNNTLKTML 156
            .|.   |.:.|::|:...| ||:.|:.|..|:|.|.:.||..:|
 Frog   155 SVL---TGKRSQEDIDPASLRENTDLSQPPFSDNYDDATLNELL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 18/66 (27%)
vipXP_002936422.2 Hormone_2 87..114 CDD:365889 4/12 (33%)
Hormone_2 131..157 CDD:365889 3/36 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165174871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.