DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3galt2l

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_031755260.1 Gene:b3galt2l / 100380178 XenbaseID:XB-GENE-5795334 Length:352 Species:Xenopus tropicalis


Alignment Length:288 Identity:77/288 - (26%)
Similarity:128/288 - (44%) Gaps:40/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LRVPSFTAEVPVDQP-------------------ARLTMLIKSAVGNSRRREAIRRTWGYEGRFS 108
            |.:|..|...|:..|                   ..|.:|:.:...:...|..||.|||.|..:.
 Frog    63 LNLPLSTTRHPLSPPYPYPYKFLLNPQEKCQKQKPFLVLLVIARSPDINSRLIIRETWGNESIYK 127

  Fly   109 DVHLRRVFLLGTA----EDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSE 169
            ||.:..|||:|.:    :..::.:..|...:||::|.:|||.|.|.||||::||.|.|.....:.
 Frog   128 DVAVVTVFLVGVSVNVTDRVQEQLEEEMNTYGDLVQQDFTDTYSNLTLKTLMGMEWISKYCPDAS 192

  Fly   170 FYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL-----LFAGH-VFQTSPLRHKFSKWYVSLEEYPF 228
            :.:.:|.|.:::...::..|      .||.|     .|.|. |....|:|.|..||||..|.||.
 Frog   193 YVMKIDSDMFLNVDYLVHHL------LQPGLPVRQNYFTGFIVANRGPIRDKKLKWYVPKEVYPN 251

  Fly   229 DRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDD---FRFHRPA 290
            |.:|||.....:..|....:::|..:..:.:...:|.::||...:..|...:..:   |..:|..
 Frog   252 DTYPPYPVGAGYAFSADMAKKIYDVAQTIRVVSMEDAFMGICLYEMKIPPTNPLNPYIFNGYRVD 316

  Fly   291 YKGPDSYSSVIASHEFGDPEEMTRVWNE 318
            || ...::.:||.|.:.. ||:..||.:
 Frog   317 YK-LCLFNKLIAVHGYSG-EELRDVWKD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 59/199 (30%)
b3galt2lXP_031755260.1 Galactosyl_T 113..304 CDD:419759 59/196 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136613
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm47879
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.