DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and b3gnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001123810.1 Gene:b3gnt2 / 100170561 XenbaseID:XB-GENE-957599 Length:397 Species:Xenopus tropicalis


Alignment Length:284 Identity:91/284 - (32%)
Similarity:147/284 - (51%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DKFAYLRVPSFTAEVPVDQPAR------LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVF 116
            |.|.|||..:::  :.:|||.:      |.:.|||.:....||:|||.:||.|.:.:::.:.|||
 Frog   118 DFFYYLRCKNYS--LLLDQPNKCVDKPFLLLAIKSLIPQFDRRQAIRESWGKELKINNMTVVRVF 180

  Fly   117 LLGTA--EDSEKD----VAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVD 175
            |||..  ||:..|    |.:||..|.|||...:.|::||.|||.:|.:||||...:.::|....|
 Frog   181 LLGETPPEDNYPDLSGMVKFESEIHKDILLWNYKDSFFNLTLKEVLFLRWASHSCSSAQFIFKGD 245

  Fly   176 DDYYVSAKNVLKFLGRGRQSHQPEL---LFAGHVFQ-TSPLRHKFSKWYVSLEEYPFDRWPPYVT 236
            ||.:|:...:|.:|    ::..||.   ||.|.|.: ..|.|.|..|:|:. |......:|||..
 Frog   246 DDVFVNTPLILDYL----KTLSPEKAKDLFIGDVIKDAGPHREKTLKYYIP-ESIYVGSYPPYAG 305

  Fly   237 AGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFR---FHRPAYKGPDSYS 298
            .|.|:.|....::||.|:..:.::..||||.|:...|.|:|.:....|:   ......|...||:
 Frog   306 GGGFLYSGSVAQRLYNATSRVLIYPIDDVYTGMCLEKIGVSPEKHKGFKTFDIDEKQKKSICSYT 370

  Fly   299 SVIASHEFGDPEEMTRVWNECRSA 322
            :::..|. ..|:|:..:|:..:.:
 Frog   371 NIMLVHP-RKPQEIITIWSRLQDS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 71/199 (36%)
b3gnt2NP_001123810.1 Galactosyl_T 156..348 CDD:389837 71/196 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.